Copeptin (human) trifluoroacetate salt,CAS :78362-34-2
H-Ala-Ser-Asp-Arg-Ser-Asn-Ala-Thr-Gln-Leu-Asp-Gly-Pro-Ala-Gly-Ala-Leu-Leu-Leu-Arg-Leu-Val-Gln-Leu-Ala-Gly-Ala-Pro-Glu-Pro-Phe-Glu-Pro-Ala-Gln-Pro-Asp-Ala-Tyr-OH trifluoroacetate salt
Catalog # | Pkg Size | Price(USD) | Quantity | Buy this product |
---|---|---|---|---|
R-M-802 | 0.5mg | 275.00 | + Add to cart |
|
R-M-802 | 1mg | 510.00 | + Add to cart |
|
|
Product description
Due to the high stability of copeptin in plasma and serum its measurement is not affected by the problems, which are associated with the direct measurement of AVP, and thus, is suitable to indirectly determine the release of AVP. Copeptin has emerged as a prognostic marker in a variety of diseases, such as sepsis, community-acquired pneumonia, chronic obstructive pulmonary failure, heart failure and myocardial infarction.
Appearance | N/A |
---|---|
Molecular weight | N/A |
Purity | >90% |
Solubility | N/A |
Cas | 78362-34-2 |
Sequence | ASDRSNATQLDGPAGALLLRLVQLAGAPEPFEPAQPDAY |
Molecular Formula | C₁₇₇H₂₇₉N₄₉O₅₈ |
Storage | -20℃,protected from light and moisture |
Transportation | 4-25℃ temperature for up to 2 weeks |
Stability | 1 year |
Document
Related Product