X
Email:
sales@ruixibiotech.com

Copeptin (human) trifluoroacetate salt,CAS :78362-34-2

H-Ala-Ser-Asp-Arg-Ser-Asn-Ala-Thr-Gln-Leu-Asp-Gly-Pro-Ala-Gly-Ala-Leu-Leu-Leu-Arg-Leu-Val-Gln-Leu-Ala-Gly-Ala-Pro-Glu-Pro-Phe-Glu-Pro-Ala-Gln-Pro-Asp-Ala-Tyr-OH trifluoroacetate salt

Catalog # Pkg Size Price(USD) Quantity Buy this product
R-M-802 0.5mg 275.00
- +
+ Add to cart
R-M-802 1mg 510.00
- +
+ Add to cart

Product description

Due to the high stability of copeptin in plasma and serum its measurement is not affected by the problems, which are associated with the direct measurement of AVP, and thus, is suitable to indirectly determine the release of AVP. Copeptin has emerged as a prognostic marker in a variety of diseases, such as sepsis, community-acquired pneumonia, chronic obstructive pulmonary failure, heart failure and myocardial infarction.


Appearance N/A
Molecular weight N/A
Purity >90%
Solubility N/A
Cas 78362-34-2
Sequence ASDRSNATQLDGPAGALLLRLVQLAGAPEPFEPAQPDAY
Molecular Formula C₁₇₇H₂₇₉N₄₉O₅₈
Storage -20℃,protected from light and moisture
Transportation 4-25℃ temperature for up to 2 weeks
Stability 1 year
Document

Related Product